SCOPe 2.06: Domain d1iqqa_: 1iqq A:

Lineage for d1iqqa_ (1iqq A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)

6. Protein S3-RNase [69809] (1 species)

7. Species Japanese pear (Pyrus pyrifolia) [TaxId:3767] [69810] (1 PDB entry)

8. Domain d1iqqa_: 1iqq A: [66274]

Details for d1iqqa_

PDB Entry: 1iqq, 1.5 Å

PDB Description: crystal structure of japanese pear s3-rnase

PDB Compounds: (A:) S3-RNase

SCOPe Domain Sequences for d1iqqa_:

Sequence; same for both SEQRES and ATOM records:

>d1iqqa_ d.124.1.1 (A:) S3-RNase {Japanese pear (Pyrus pyrifolia) [TaxId: 3767]}
ydyfqftqqyqlavcnsnrtlckdppdklftvhglwpsnmvgpdpskcpiknirkrekll
ehqleiiwpnvfdrtknnlfwdkewmkhgscgyptidnenhyfetvikmyiskkqnvsri
lskakiepdgkkralldienairngadnkkpklkcqkkgtttelveitlcsdksgehfid
cphpfepisphycptnniky

Timeline for d1iqqa_:

• d1iqqa_ first appeared in SCOP 1.59
  
• d1iqqa_ appears in SCOPe 2.05
  
• d1iqqa_ appears in SCOPe 2.07
  
• d1iqqa_ appears in the current release, SCOPe 2.08