Lineage for d1iqqa_ (1iqq A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417929Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 417930Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) (S)
  5. 417931Family d.124.1.1: Ribonuclease Rh-like [55896] (7 proteins)
  6. 417959Protein S3-RNase [69809] (1 species)
  7. 417960Species Japanese pear (Pyrus pyrifolia) [TaxId:3767] [69810] (1 PDB entry)
  8. 417961Domain d1iqqa_: 1iqq A: [66274]
    complexed with man, nag, xys

Details for d1iqqa_

PDB Entry: 1iqq (more details), 1.5 Å

PDB Description: crystal structure of japanese pear s3-rnase

SCOP Domain Sequences for d1iqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqqa_ d.124.1.1 (A:) S3-RNase {Japanese pear (Pyrus pyrifolia)}
ydyfqftqqyqlavcnsnrtlckdppdklftvhglwpsnmvgpdpskcpiknirkrekll
ehqleiiwpnvfdrtknnlfwdkewmkhgscgyptidnenhyfetvikmyiskkqnvsri
lskakiepdgkkralldienairngadnkkpklkcqkkgtttelveitlcsdksgehfid
cphpfepisphycptnniky

SCOP Domain Coordinates for d1iqqa_:

Click to download the PDB-style file with coordinates for d1iqqa_.
(The format of our PDB-style files is described here.)

Timeline for d1iqqa_: