![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein) duplication: contains two cytochrome c-type domains |
![]() | Protein Di-heme cytochrome c peroxidase [46686] (3 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry) |
![]() | Domain d1iqcc1: 1iqc C:1-150 [66270] complexed with ca, gol, hem, mg |
PDB Entry: 1iqc (more details), 1.8 Å
SCOPe Domain Sequences for d1iqcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqcc1 a.3.1.5 (C:1-150) Di-heme cytochrome c peroxidase {Nitrosomonas europaea [TaxId: 915]} anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy rerfkkvfgsdevtidrittaiaqfeetlv
Timeline for d1iqcc1: