SCOP 1.73: Domain d1iqcb2: 1iqc B:151-308

Lineage for d1iqcb2 (1iqc B:151-308)

Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds)
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, opened
Superfamily a.3.1: Cytochrome c [46626] (8 families)
covalently-bound heme completes the core
Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
duplication: contains two cytochrome c-type domains
Protein Di-heme cytochrome c peroxidase [46686] (3 species)
Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry)
Domain d1iqcb2: 1iqc B:151-308 [66269]

Details for d1iqcb2

PDB Entry: 1iqc (more details), 1.8 Å

PDB Description: crystal structure of di-heme peroxidase from nitrosomonas europaea

PDB Compounds: (B:) di-heme peroxidase

SCOP Domain Sequences for d1iqcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqcb2 a.3.1.5 (B:151-308) Di-heme cytochrome c peroxidase {Nitrosomonas europaea [TaxId: 915]}
tpgskfdkwlegdknalnqdelegynlfkgsgcvqchngpavggssyqkmgvfkpyetkn
paagrmdvtgneadrnvfkvptlrnieltypyfhdggaatleqavetmgriqlnrefnkd
evskivaflktltgdqpdfklpilppsnndtprsqpye

SCOP Domain Coordinates for d1iqcb2:

Click to download the PDB-style file with coordinates for d1iqcb2.
(The format of our PDB-style files is described here.)

Timeline for d1iqcb2: