Lineage for d1iqcb2 (1iqc B:151-308)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94872Family a.3.1.5: Di-haem cytochrome c peroxidase [46685] (1 protein)
  6. 94873Protein Di-haem cytochrome c peroxidase [46686] (2 species)
  7. 94874Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry)
  8. 94878Domain d1iqcb2: 1iqc B:151-308 [66269]

Details for d1iqcb2

PDB Entry: 1iqc (more details), 1.8 Å

PDB Description: crystal structure of di-heme peroxidase from nitrosomonas europaea

SCOP Domain Sequences for d1iqcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqcb2 a.3.1.5 (B:151-308) Di-haem cytochrome c peroxidase {Nitrosomonas europaea}
tpgskfdkwlegdknalnqdelegynlfkgsgcvqchngpavggssyqkmgvfkpyetkn
paagrmdvtgneadrnvfkvptlrnieltypyfhdggaatleqavetmgriqlnrefnkd
evskivaflktltgdqpdfklpilppsnndtprsqpye

SCOP Domain Coordinates for d1iqcb2:

Click to download the PDB-style file with coordinates for d1iqcb2.
(The format of our PDB-style files is described here.)

Timeline for d1iqcb2: