Lineage for d1iqca1 (1iqc A:1-150)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149762Family a.3.1.5: Di-haem cytochrome c peroxidase [46685] (1 protein)
  6. 149763Protein Di-haem cytochrome c peroxidase [46686] (2 species)
  7. 149764Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry)
  8. 149765Domain d1iqca1: 1iqc A:1-150 [66266]

Details for d1iqca1

PDB Entry: 1iqc (more details), 1.8 Å

PDB Description: crystal structure of di-heme peroxidase from nitrosomonas europaea

SCOP Domain Sequences for d1iqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqca1 a.3.1.5 (A:1-150) Di-haem cytochrome c peroxidase {Nitrosomonas europaea}
anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
rerfkkvfgsdevtidrittaiaqfeetlv

SCOP Domain Coordinates for d1iqca1:

Click to download the PDB-style file with coordinates for d1iqca1.
(The format of our PDB-style files is described here.)

Timeline for d1iqca1: