Lineage for d1iqbb1 (1iqb B:1-45)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521094Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 521095Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (6 proteins)
  6. 521105Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 521106Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 521119Domain d1iqbb1: 1iqb B:1-45 [66264]

Details for d1iqbb1

PDB Entry: 1iqb (more details), 1.9 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin i

SCOP Domain Sequences for d1iqbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqbb1 g.3.1.1 (B:1-45) Isolectin VI {Stinging nettle (Urtica dioica), UDA}
ercgsqggggtcpalwccsiwgwcgdsepycgrtcenkcwsgers

SCOP Domain Coordinates for d1iqbb1:

Click to download the PDB-style file with coordinates for d1iqbb1.
(The format of our PDB-style files is described here.)

Timeline for d1iqbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqbb2