Lineage for d1iq7a_ (1iq7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145370Family c.94.1.2: Transferrin [53888] (4 protein domains)
    further duplication: composed of two two-domain lobes
  6. 2145455Protein Ovotransferrin [53894] (2 species)
  7. 2145456Species Chicken (Gallus gallus) [TaxId:9031] [53896] (9 PDB entries)
    Uniprot P02789
  8. 2145460Domain d1iq7a_: 1iq7 A: [66261]
    C-terminal lobe only
    complexed with nag, so4

Details for d1iq7a_

PDB Entry: 1iq7 (more details), 2.3 Å

PDB Description: Ovotransferrin, C-Terminal Lobe, Apo Form
PDB Compounds: (A:) Ovotransferrin

SCOPe Domain Sequences for d1iq7a_:

Sequence, based on SEQRES records: (download)

>d1iq7a_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]}
riqwcavgkdekskcdrwsvvsngdvectvvdetkdciikimkgeadavaldgglvytag
vcglvpvmaeryddesqcsktderpasyfavavarkdsnvnwnnlkgkkschtavgrtag
wvipmglihnrtgtcnfdeyfsegcapgsppnsrlcqlcqgsggippekcvasshekyfg
ytgalrclvekgdvafiqhstveentggknkadwaknlqmddfellctdgrranvmdyre
cnlaevpthavvvrpekankirdllerqekrfgvngsekskfmmfesqnkdllfkdltkc
lfkvregttykeflgdkfytvisslktcnpsdilqmcsflegk

Sequence, based on observed residues (ATOM records): (download)

>d1iq7a_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]}
riqwcavgkdekskcdrwsvvsngdvectvvdetkdciikimkgeadavaldgglvytag
vcglvpvmaeryddescskderpasyfavavarkdsnvnwnnlkgkkschtavgrtagwv
ipmglihnrtgtcnfdeyfsegcapgsppnsrlcqlcqgsggippekcvasshekyfgyt
galrclvekgdvafiqhstveentggknkadwaknlqmddfellctdgrranvmdyrecn
laevpthavvvrpekankirdllerqekrfgvngsekskfmmfesqnkdllfkdltkclf
kvregttykeflgdkfytvisslktcnpsdilqmcsflegk

SCOPe Domain Coordinates for d1iq7a_:

Click to download the PDB-style file with coordinates for d1iq7a_.
(The format of our PDB-style files is described here.)

Timeline for d1iq7a_: