![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (3 superfamilies) |
![]() | Superfamily d.67.2: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55190] (1 family) ![]() |
![]() | Family d.67.2.1: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55191] (1 protein) |
![]() | Protein Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55192] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [69749] (1 PDB entry) |
![]() | Domain d1iq0a3: 1iq0 A:1-96 [66259] Other proteins in same PDB: d1iq0a1, d1iq0a2 |
PDB Entry: 1iq0 (more details), 2.3 Å
SCOP Domain Sequences for d1iq0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iq0a3 d.67.2.1 (A:1-96) Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain {Thermus thermophilus} mlrraleeaiaqalkemgvpvrlkvarapkdkpgdygvplfalakelrkppqaiaqelkd rlplpefveeavpvggylnfrlrteallrealrpka
Timeline for d1iq0a3: