Lineage for d1iq0a3 (1iq0 A:1-96)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134446Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (3 superfamilies)
  4. 134452Superfamily d.67.2: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55190] (1 family) (S)
  5. 134453Family d.67.2.1: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55191] (1 protein)
  6. 134454Protein Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55192] (2 species)
  7. 134459Species Thermus thermophilus [TaxId:274] [69749] (1 PDB entry)
  8. 134460Domain d1iq0a3: 1iq0 A:1-96 [66259]
    Other proteins in same PDB: d1iq0a1, d1iq0a2

Details for d1iq0a3

PDB Entry: 1iq0 (more details), 2.3 Å

PDB Description: thermus thermophilus arginyl-trna synthetase

SCOP Domain Sequences for d1iq0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq0a3 d.67.2.1 (A:1-96) Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain {Thermus thermophilus}
mlrraleeaiaqalkemgvpvrlkvarapkdkpgdygvplfalakelrkppqaiaqelkd
rlplpefveeavpvggylnfrlrteallrealrpka

SCOP Domain Coordinates for d1iq0a3:

Click to download the PDB-style file with coordinates for d1iq0a3.
(The format of our PDB-style files is described here.)

Timeline for d1iq0a3: