Lineage for d1iq0a2 (1iq0 A:97-466)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392102Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 392103Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 392104Protein Arginyl-tRNA synthetase (ArgRS) [52392] (2 species)
  7. 392109Species Thermus thermophilus [TaxId:274] [69454] (1 PDB entry)
  8. 392110Domain d1iq0a2: 1iq0 A:97-466 [66258]
    Other proteins in same PDB: d1iq0a1, d1iq0a3

Details for d1iq0a2

PDB Entry: 1iq0 (more details), 2.3 Å

PDB Description: thermus thermophilus arginyl-trna synthetase

SCOP Domain Sequences for d1iq0a2:

Sequence, based on SEQRES records: (download)

>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus}
pfprrpgvvlvehtsvnpnkelhvghlrnialgdaiarilayagrevlvlnyiddtgrqa
aetlfalrhygltwdgkekydhfagrayvrlhqdpeyerlqpaieevlhalergelreev
nrillaqmatmhalnarydllvwesdivragllqkalalleqsphvfrpregkyagalvm
daspvipgledpffvllrsngtatyyakdiafqfwkmgileglrfrpyenpyypglrtsa
pegeaytpkaeetinvvdvrqshpqalvraalalagypalaekahhlayetvllegrqms
grkglavsvdevleeatrraraiveeknpdhpdkeeaarmvalgairfsmvktepkkqid
fryqealsfe

Sequence, based on observed residues (ATOM records): (download)

>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus}
pfprrpgvvlvehtsvnpnkelhvghlrnialgdaiarilayagrevlvlnyiddtgrqa
aetlfalrhygltwdgkekydhfagrayvrlhqdpeyerlqpaieevlhalergelreev
nrillaqmatmhalnarydllvwesdivragllqkalalleqsphvfrpregkyagalvm
daspvipgledpffvllrsngtatyyakdiafqfwkmgileglrfrpyenpyypglrtsa
pegeaytpkaeetinvvdvrqshpqalvraalalagypalaekahhlayetvllegrqms
gavsvdevleeatrraraiveeknpdhpdkeeaarmvalgairfsmvktepkkqidfryq
ealsfe

SCOP Domain Coordinates for d1iq0a2:

Click to download the PDB-style file with coordinates for d1iq0a2.
(The format of our PDB-style files is described here.)

Timeline for d1iq0a2: