![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [69007] (1 PDB entry) |
![]() | Domain d1iq0a1: 1iq0 A:467-592 [66257] Other proteins in same PDB: d1iq0a2, d1iq0a3 |
PDB Entry: 1iq0 (more details), 2.3 Å
SCOPe Domain Sequences for d1iq0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iq0a1 a.27.1.1 (A:467-592) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} gdtgpyvqyaharahsilrkagewgapdlsqatpyeralaldlldfeeavleaaeertph vlaqylldlaaswnayynarengqpatpvltapeglrelrlslvqslqrtlatgldllgi papevm
Timeline for d1iq0a1: