Lineage for d1iq0a1 (1iq0 A:467-592)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487290Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1487291Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1487292Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1487293Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species)
  7. 1487298Species Thermus thermophilus [TaxId:274] [69007] (1 PDB entry)
  8. 1487299Domain d1iq0a1: 1iq0 A:467-592 [66257]
    Other proteins in same PDB: d1iq0a2, d1iq0a3

Details for d1iq0a1

PDB Entry: 1iq0 (more details), 2.3 Å

PDB Description: thermus thermophilus arginyl-trna synthetase
PDB Compounds: (A:) arginyl-tRNA synthetase

SCOPe Domain Sequences for d1iq0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq0a1 a.27.1.1 (A:467-592) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]}
gdtgpyvqyaharahsilrkagewgapdlsqatpyeralaldlldfeeavleaaeertph
vlaqylldlaaswnayynarengqpatpvltapeglrelrlslvqslqrtlatgldllgi
papevm

SCOPe Domain Coordinates for d1iq0a1:

Click to download the PDB-style file with coordinates for d1iq0a1.
(The format of our PDB-style files is described here.)

Timeline for d1iq0a1: