SCOP 1.73: Domain d1iq0a1: 1iq0 A:467-592

Lineage for d1iq0a1 (1iq0 A:467-592)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species)

7. Species Thermus thermophilus [TaxId:274] [69007] (1 PDB entry)

8. Domain d1iq0a1: 1iq0 A:467-592 [66257]
   Other proteins in same PDB: d1iq0a2, d1iq0a3

Details for d1iq0a1

PDB Entry: 1iq0, 2.3 Å

PDB Description: thermus thermophilus arginyl-trna synthetase

PDB Compounds: (A:) arginyl-tRNA synthetase

SCOP Domain Sequences for d1iq0a1:

Sequence; same for both SEQRES and ATOM records:

>d1iq0a1 a.27.1.1 (A:467-592) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]}
gdtgpyvqyaharahsilrkagewgapdlsqatpyeralaldlldfeeavleaaeertph
vlaqylldlaaswnayynarengqpatpvltapeglrelrlslvqslqrtlatgldllgi
papevm

Timeline for d1iq0a1:

• d1iq0a1 first appeared in SCOP 1.59
  
• d1iq0a1 appears in SCOP 1.71
  
• d1iq0a1 appears in SCOP 1.75
  
• d1iq0a1 appears in the current release, SCOPe 2.08