Lineage for d1ipia_ (1ipi A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1170598Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1170812Family c.52.1.18: Hjc-like [64080] (3 proteins)
    Pfam PF01870
  6. 1170813Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 1170814Species Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries)
  8. 1170819Domain d1ipia_: 1ipi A: [66255]

Details for d1ipia_

PDB Entry: 1ipi (more details), 2.16 Å

PDB Description: crystal structure of the archaeal holliday junction resolvase hjc from pyrococcus furiosus form ii
PDB Compounds: (A:) holliday junction resolvase

SCOPe Domain Sequences for d1ipia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ipia_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Pyrococcus furiosus [TaxId: 2261]}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllg

SCOPe Domain Coordinates for d1ipia_:

Click to download the PDB-style file with coordinates for d1ipia_.
(The format of our PDB-style files is described here.)

Timeline for d1ipia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ipib_