![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.18: Hjc-like [64080] (3 proteins) Pfam PF01870 |
![]() | Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries) |
![]() | Domain d1ipia_: 1ipi A: [66255] |
PDB Entry: 1ipi (more details), 2.16 Å
SCOPe Domain Sequences for d1ipia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ipia_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Pyrococcus furiosus [TaxId: 2261]} myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllg
Timeline for d1ipia_: