SCOP 1.65: Domain d1ip7b_: 1ip7 B:

Lineage for d1ip7b_ (1ip7 B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (202 PDB entries)

8. Domain d1ip7b_: 1ip7 B: [66254]
   complexed with na; mutant

Details for d1ip7b_

PDB Entry: 1ip7, 1.9 Å

PDB Description: g129a human lysozyme

SCOP Domain Sequences for d1ip7b_:

Sequence; same for both SEQRES and ATOM records:

>d1ip7b_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcav

Timeline for d1ip7b_:

• d1ip7b_ first appeared in SCOP 1.59
  
• d1ip7b_ appears in SCOP 1.63
  
• d1ip7b_ appears in SCOP 1.67
  
• d1ip7b_ appears in the current release, SCOPe 2.08