Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in all proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein) |
Protein GroEL, A domain [52031] (3 species) |
Species Paracoccus denitrificans [TaxId:266] [69430] (1 PDB entry) |
Domain d1iokf2: 1iok F:191-366 [66240] Other proteins in same PDB: d1ioka1, d1ioka3, d1iokb1, d1iokb3, d1iokc1, d1iokc3, d1iokd1, d1iokd3, d1ioke1, d1ioke3, d1iokf1, d1iokf3, d1iokg1, d1iokg3 |
PDB Entry: 1iok (more details), 3.2 Å
SCOP Domain Sequences for d1iokf2:
Sequence, based on SEQRES records: (download)
>d1iokf2 c.8.5.1 (F:191-366) GroEL, A domain {Paracoccus denitrificans} egmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesviqsqkplliv aedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqvisedlgmkle nvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdydreklq
>d1iokf2 c.8.5.1 (F:191-366) GroEL, A domain {Paracoccus denitrificans} egmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivaedveiaavka pgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiearvsqirqqi eettsdydreklq
Timeline for d1iokf2: