Lineage for d1iokc1 (1iok C:2-136,C:410-526)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448721Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 448722Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 448723Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 448724Protein GroEL, E domain [48594] (3 species)
  7. 448832Species Paracoccus denitrificans [TaxId:266] [69116] (1 PDB entry)
  8. 448835Domain d1iokc1: 1iok C:2-136,C:410-526 [66230]
    Other proteins in same PDB: d1ioka2, d1ioka3, d1iokb2, d1iokb3, d1iokc2, d1iokc3, d1iokd2, d1iokd3, d1ioke2, d1ioke3, d1iokf2, d1iokf3, d1iokg2, d1iokg3

Details for d1iokc1

PDB Entry: 1iok (more details), 3.2 Å

PDB Description: crystal structure of chaperonin-60 from paracoccus denitrificans

SCOP Domain Sequences for d1iokc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iokc1 a.129.1.1 (C:2-136,C:410-526) GroEL, E domain {Paracoccus denitrificans}
aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
vatakvveaiksaarXgivvgggvalvqgakvleglsgansdqdagiaiirraleapmrq
iaenagvdgavvagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvag
llitteamiaekp

SCOP Domain Coordinates for d1iokc1:

Click to download the PDB-style file with coordinates for d1iokc1.
(The format of our PDB-style files is described here.)

Timeline for d1iokc1: