Lineage for d1iokb1 (1iok B:2-136,B:410-526)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648737Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 648738Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 648739Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 648740Protein GroEL, E domain [48594] (4 species)
  7. 648857Species Paracoccus denitrificans [TaxId:266] [69116] (1 PDB entry)
  8. 648859Domain d1iokb1: 1iok B:2-136,B:410-526 [66227]
    Other proteins in same PDB: d1ioka2, d1ioka3, d1iokb2, d1iokb3, d1iokc2, d1iokc3, d1iokd2, d1iokd3, d1ioke2, d1ioke3, d1iokf2, d1iokf3, d1iokg2, d1iokg3

Details for d1iokb1

PDB Entry: 1iok (more details), 3.2 Å

PDB Description: crystal structure of chaperonin-60 from paracoccus denitrificans
PDB Compounds: (B:) chaperonin 60

SCOP Domain Sequences for d1iokb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iokb1 a.129.1.1 (B:2-136,B:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]}
aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
vatakvveaiksaarXgivvgggvalvqgakvleglsgansdqdagiaiirraleapmrq
iaenagvdgavvagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvag
llitteamiaekp

SCOP Domain Coordinates for d1iokb1:

Click to download the PDB-style file with coordinates for d1iokb1.
(The format of our PDB-style files is described here.)

Timeline for d1iokb1: