Lineage for d1inlb_ (1inl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129722Family c.66.1.17: Spermidine synthase [69557] (3 protein domains)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2129727Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 2129755Species Thermotoga maritima [TaxId:2336] [69559] (2 PDB entries)
  8. 2129757Domain d1inlb_: 1inl B: [66221]

Details for d1inlb_

PDB Entry: 1inl (more details), 1.5 Å

PDB Description: crystal structure of spermidine synthase from thermotoga maritima
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d1inlb_:

Sequence, based on SEQRES records: (download)

>d1inlb_ c.66.1.17 (B:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}
rtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfa
ldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailce
vdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqggh
lfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyps
gmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm

Sequence, based on observed residues (ATOM records): (download)

>d1inlb_ c.66.1.17 (B:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}
rtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfa
ldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailce
vdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptahlfte
efyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgmws
ytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm

SCOPe Domain Coordinates for d1inlb_:

Click to download the PDB-style file with coordinates for d1inlb_.
(The format of our PDB-style files is described here.)

Timeline for d1inlb_: