Lineage for d1inia_ (1ini A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (11 families) 
Family c.68.1.13: Cytidylytransferase [68901] (3 proteins) 
Protein 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) [64140] (1 species) Species Escherichia coli [TaxId:562] [64141] (3 PDB entries) 
Domain d1inia_: 1ini A: [66219]
Details for d1inia_
PDB Entry: 1ini (more details), 1.82 Å
PDB Description: crystal structure of 4-diphosphocytidyl-2-c-methylerythritol (cdp-me) synthetase (ygbp) involved in mevalonate independent isoprenoid biosynthesis, complexed with cdp-me and mg2+
SCOP Domain Sequences for d1inia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1inia_ c.68.1.13 (A:) 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) {Escherichia coli}
thldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgds
rfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllal
setsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltraln
egatitdeasaleycgfhpqlvegradnikvtrpedlalaefylt
SCOP Domain Coordinates for d1inia_:
Click to download the PDB-style file with coordinates for d1inia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1inia_:
- d1inia_ is new in SCOP 1.59
- d1inia_ appears in SCOP 1.61
- d1inia_ appears in the current release, SCOPe 2.08
View in 3D