Lineage for d1imhd2 (1imh D:188-367)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041189Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2041258Protein T-cell transcription factor NFAT5 (TONEBP), DNA-binding domain [69185] (1 species)
  7. 2041259Species Human (Homo sapiens) [TaxId:9606] [69186] (1 PDB entry)
  8. 2041261Domain d1imhd2: 1imh D:188-367 [66217]
    Other proteins in same PDB: d1imhc1, d1imhd1
    protein/DNA complex

Details for d1imhd2

PDB Entry: 1imh (more details), 2.86 Å

PDB Description: tonebp/dna complex
PDB Compounds: (D:) nuclear factor of activated t cells 5

SCOPe Domain Sequences for d1imhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imhd2 b.2.5.3 (D:188-367) T-cell transcription factor NFAT5 (TONEBP), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
kkspmlcgqypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghne
pvvlqvfvgndsgrvkphgfyqacrvtgrnttpckevdiegttvievgldpsnnmtlavd
cvgilklrnadvearigiagskkkstrarlvfrvnimrkdgstltlqtpsspilctqpag

SCOPe Domain Coordinates for d1imhd2:

Click to download the PDB-style file with coordinates for d1imhd2.
(The format of our PDB-style files is described here.)

Timeline for d1imhd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1imhd1