Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
Protein T-cell transcription factor NFAT5 (TONEBP), DNA-binding domain [69185] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69186] (1 PDB entry) |
Domain d1imhd2: 1imh D:188-367 [66217] Other proteins in same PDB: d1imhc1, d1imhd1 protein/DNA complex |
PDB Entry: 1imh (more details), 2.86 Å
SCOPe Domain Sequences for d1imhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1imhd2 b.2.5.3 (D:188-367) T-cell transcription factor NFAT5 (TONEBP), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} kkspmlcgqypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghne pvvlqvfvgndsgrvkphgfyqacrvtgrnttpckevdiegttvievgldpsnnmtlavd cvgilklrnadvearigiagskkkstrarlvfrvnimrkdgstltlqtpsspilctqpag
Timeline for d1imhd2: