SCOP 1.59: Domain d1imhd1: 1imh D:368-468

Lineage for d1imhd1 (1imh D:368-468)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (25 proteins)

6. Protein Transcription factor TONEBP, C-terminal domain [69170] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69171] (1 PDB entry)

8. Domain d1imhd1: 1imh D:368-468 [66216]
   Other proteins in same PDB: d1imhc2, d1imhd2

Details for d1imhd1

PDB Entry: 1imh, 2.86 Å

PDB Description: tonebp/dna complex

SCOP Domain Sequences for d1imhd1:

Sequence; same for both SEQRES and ATOM records:

>d1imhd1 b.1.1.5 (D:368-468) Transcription factor TONEBP, C-terminal domain {Human (Homo sapiens)}
vpeilkkslhscsvkgeeevfligknflkgtkvifqenvsdenswkseaeidmelfhqnh
livkvppyhdqhitlpvsvgiyvvtnagrshdvqpftytpd

Timeline for d1imhd1:

• d1imhd1 is new in SCOP 1.59
  
• d1imhd1 appears in SCOP 1.61
  
• d1imhd1 appears in the current release, SCOPe 2.08