Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
Protein T-cell transcription factor NFAT5 (TONEBP) [69170] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69171] (1 PDB entry) |
Domain d1imhc1: 1imh C:368-468 [66214] Other proteins in same PDB: d1imhc2, d1imhd2 protein/DNA complex |
PDB Entry: 1imh (more details), 2.86 Å
SCOPe Domain Sequences for d1imhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]} vpeilkkslhscsvkgeeevfligknflkgtkvifqenvsdenswkseaeidmelfhqnh livkvppyhdqhitlpvsvgiyvvtnagrshdvqpftytpd
Timeline for d1imhc1: