SCOPe 2.06: Domain d1imhc1: 1imh C:368-468

Lineage for d1imhc1 (1imh C:368-468)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein T-cell transcription factor NFAT5 (TONEBP) [69170] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69171] (1 PDB entry)

8. Domain d1imhc1: 1imh C:368-468 [66214]
   Other proteins in same PDB: d1imhc2, d1imhd2
   protein/DNA complex

Details for d1imhc1

PDB Entry: 1imh, 2.86 Å

PDB Description: tonebp/dna complex

PDB Compounds: (C:) nuclear factor of activated t cells 5

SCOPe Domain Sequences for d1imhc1:

Sequence; same for both SEQRES and ATOM records:

>d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]}
vpeilkkslhscsvkgeeevfligknflkgtkvifqenvsdenswkseaeidmelfhqnh
livkvppyhdqhitlpvsvgiyvvtnagrshdvqpftytpd

Timeline for d1imhc1:

• d1imhc1 first appeared in SCOP 1.59
  
• d1imhc1 appears in SCOPe 2.05
  
• d1imhc1 appears in SCOPe 2.07
  
• d1imhc1 appears in the current release, SCOPe 2.08