Lineage for d1imhc1 (1imh C:368-468)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. Protein T-cell transcription factor NFAT5 (TONEBP) [69170] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69171] (1 PDB entry)
  8. Domain d1imhc1: 1imh C:368-468 [66214]
    Other proteins in same PDB: d1imhc2, d1imhd2
    protein/DNA complex

Details for d1imhc1

PDB Entry: 1imh (more details), 2.86 Å

PDB Description: tonebp/dna complex
PDB Compounds: (C:) nuclear factor of activated t cells 5

SCOPe Domain Sequences for d1imhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]}
vpeilkkslhscsvkgeeevfligknflkgtkvifqenvsdenswkseaeidmelfhqnh
livkvppyhdqhitlpvsvgiyvvtnagrshdvqpftytpd

SCOPe Domain Coordinates for d1imhc1 are not available.

Timeline for d1imhc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1imhc2
View in 3D
Domains from other chains:
(mouse over for more information)
d1imhd1, d1imhd2