SCOPe 2.06: Domain d1ilwa_: 1ilw A:

Lineage for d1ilwa_ (1ilw A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)

6. Protein Pyrazinamidase/nicotinamidase [69465] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [69466] (2 PDB entries)

8. Domain d1ilwa_: 1ilw A: [66208]

Details for d1ilwa_

PDB Entry: 1ilw, 2.05 Å

PDB Description: Crystal Structure of Pyrazinamidase/Nicotinamidase of Pyrococcus horikoshii

PDB Compounds: (A:) 180 aa long hypothetical Pyrazinamidase/nicotinamidase

SCOPe Domain Sequences for d1ilwa_:

Sequence; same for both SEQRES and ATOM records:

>d1ilwa_ c.33.1.3 (A:) Pyrazinamidase/nicotinamidase {Pyrococcus horikoshii [TaxId: 53953]}
peealivvdmqrdfmpggalpvpegdkiipkvneyirkfkekgalivatrdwhpenhisf
rerggpwprhcvqntpgaefvvdlpedaviiskatepdkeaysgfegtdlakilrgngvk
rvyicgvateycvrataldalkhgfevyllrdavkgikpedeeraleemksrgikivqf

Timeline for d1ilwa_:

• d1ilwa_ first appeared in SCOP 1.59
  
• d1ilwa_ appears in SCOPe 2.05
  
• d1ilwa_ appears in SCOPe 2.07
  
• d1ilwa_ appears in the current release, SCOPe 2.08