Lineage for d1ilwa_ (1ilw A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483313Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 483314Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (1 family) (S)
  5. 483315Family c.33.1.3: Isochorismatase-like hydrolases [100948] (6 proteins)
  6. 483332Protein Pyrazinamidase/nicotinamidase [69465] (1 species)
  7. 483333Species Archaeon Pyrococcus horikoshii [TaxId:53953] [69466] (2 PDB entries)
  8. 483335Domain d1ilwa_: 1ilw A: [66208]

Details for d1ilwa_

PDB Entry: 1ilw (more details), 2.05 Å

PDB Description: Crystal Structure of Pyrazinamidase/Nicotinamidase of Pyrococcus horikoshii

SCOP Domain Sequences for d1ilwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilwa_ c.33.1.3 (A:) Pyrazinamidase/nicotinamidase {Archaeon Pyrococcus horikoshii}
peealivvdmqrdfmpggalpvpegdkiipkvneyirkfkekgalivatrdwhpenhisf
rerggpwprhcvqntpgaefvvdlpedaviiskatepdkeaysgfegtdlakilrgngvk
rvyicgvateycvrataldalkhgfevyllrdavkgikpedeeraleemksrgikivqf

SCOP Domain Coordinates for d1ilwa_:

Click to download the PDB-style file with coordinates for d1ilwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ilwa_: