Lineage for d1ilwa_ (1ilw A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121492Fold c.33: Cysteine hydrolase [52498] (1 superfamily)
  4. 121493Superfamily c.33.1: Cysteine hydrolase [52499] (2 families) (S)
  5. 121501Family c.33.1.2: Pyrazinamidase/nicotinamidase-like [52503] (2 protein domains)
  6. 121502Protein Pyrazinamidase/nicotinamidase [69465] (1 species)
  7. 121503Species Archaeon Pyrococcus horikoshii [TaxId:53953] [69466] (2 PDB entries)
  8. 121505Domain d1ilwa_: 1ilw A: [66208]

Details for d1ilwa_

PDB Entry: 1ilw (more details), 2.05 Å

PDB Description: Crystal Structure of Pyrazinamidase/Nicotinamidase of Pyrococcus horikoshii

SCOP Domain Sequences for d1ilwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilwa_ c.33.1.2 (A:) Pyrazinamidase/nicotinamidase {Archaeon Pyrococcus horikoshii}
peealivvdmqrdfmpggalpvpegdkiipkvneyirkfkekgalivatrdwhpenhisf
rerggpwprhcvqntpgaefvvdlpedaviiskatepdkeaysgfegtdlakilrgngvk
rvyicgvateycvrataldalkhgfevyllrdavkgikpedeeraleemksrgikivqf

SCOP Domain Coordinates for d1ilwa_:

Click to download the PDB-style file with coordinates for d1ilwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ilwa_: