SCOPe 2.05: Domain d1ilvb_: 1ilv B:

Lineage for d1ilvb_ (1ilv B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.1: SurE-like [64168] (2 proteins)

6. Protein SurE homolog TM1662 [64169] (1 species)
   has a phosphatase activity

7. Species Thermotoga maritima [TaxId:2336] [64170] (4 PDB entries)

8. Domain d1ilvb_: 1ilv B: [66207]
   structural genomics; target TM107

Details for d1ilvb_

PDB Entry: 1ilv, 2 Å

PDB Description: crystal structure analysis of the tm107

PDB Compounds: (B:) stationary-phase survival protein sure homolog

SCOPe Domain Sequences for d1ilvb_:

Sequence; same for both SEQRES and ATOM records:

>d1ilvb_ c.106.1.1 (B:) SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]}
mrilvtnddgiqskgiivlaellseehevfvvapdkersatghsitihvplwmkkvfise
rvvaysttgtpadcvklaynvvmdkrvdlivsgvnrgpnmgmdilhsgtvsgamegammn
ipsiaissanyespdfegaarflidflkefdfslldpftmlninvpageikgwrftrqsr
rrwndyfeervspfgekyywmmgeviedddrddvdykavregyvsitpihpfltneqclk
klrevyd

Timeline for d1ilvb_:

• d1ilvb_ first appeared in SCOP 1.59
  
• d1ilvb_ appears in SCOPe 2.04
  
• d1ilvb_ appears in SCOPe 2.06
  
• d1ilvb_ appears in the current release, SCOPe 2.08