| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.106: SurE-like [64166] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7 |
Superfamily c.106.1: SurE-like [64167] (2 families) ![]() some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family |
| Family c.106.1.1: SurE-like [64168] (2 proteins) |
| Protein SurE homolog TM1662 [64169] (1 species) has a phosphatase activity |
| Species Thermotoga maritima [TaxId:2336] [64170] (4 PDB entries) |
| Domain d1ilvb_: 1ilv B: [66207] structural genomics; target TM107 |
PDB Entry: 1ilv (more details), 2 Å
SCOPe Domain Sequences for d1ilvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ilvb_ c.106.1.1 (B:) SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]}
mrilvtnddgiqskgiivlaellseehevfvvapdkersatghsitihvplwmkkvfise
rvvaysttgtpadcvklaynvvmdkrvdlivsgvnrgpnmgmdilhsgtvsgamegammn
ipsiaissanyespdfegaarflidflkefdfslldpftmlninvpageikgwrftrqsr
rrwndyfeervspfgekyywmmgeviedddrddvdykavregyvsitpihpfltneqclk
klrevyd
Timeline for d1ilvb_: