Lineage for d1ilvb_ (1ilv B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187512Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 1187513Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 1187514Family c.106.1.1: SurE-like [64168] (2 proteins)
  6. 1187519Protein SurE homolog TM1662 [64169] (1 species)
    has a phosphatase activity
  7. 1187520Species Thermotoga maritima [TaxId:2336] [64170] (4 PDB entries)
  8. 1187528Domain d1ilvb_: 1ilv B: [66207]
    structural genomics; target TM107

Details for d1ilvb_

PDB Entry: 1ilv (more details), 2 Å

PDB Description: crystal structure analysis of the tm107
PDB Compounds: (B:) stationary-phase survival protein sure homolog

SCOPe Domain Sequences for d1ilvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilvb_ c.106.1.1 (B:) SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]}
mrilvtnddgiqskgiivlaellseehevfvvapdkersatghsitihvplwmkkvfise
rvvaysttgtpadcvklaynvvmdkrvdlivsgvnrgpnmgmdilhsgtvsgamegammn
ipsiaissanyespdfegaarflidflkefdfslldpftmlninvpageikgwrftrqsr
rrwndyfeervspfgekyywmmgeviedddrddvdykavregyvsitpihpfltneqclk
klrevyd

SCOPe Domain Coordinates for d1ilvb_:

Click to download the PDB-style file with coordinates for d1ilvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ilvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ilva_