Lineage for d1il2b3 (1il2 B:1107-1287,B:1421-1585)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920687Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 1920694Species Escherichia coli [TaxId:562] [55699] (3 PDB entries)
  8. 1920697Domain d1il2b3: 1il2 B:1107-1287,B:1421-1585 [66198]
    Other proteins in same PDB: d1il2a1, d1il2a2, d1il2b1, d1il2b2
    protein/RNA complex; complexed with amo, so4

Details for d1il2b3

PDB Entry: 1il2 (more details), 2.6 Å

PDB Description: Crystal Structure of the E. coli Aspartyl-tRNA Synthetase:Yeast tRNAasp:aspartyl-Adenylate Complex
PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1il2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il2b3 d.104.1.1 (B:1107-1287,B:1421-1585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]}
vlpldsnhvnteearlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmlt
katpegardylvpsrvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrq
peftqidvetsfmtapqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdl
rXdeskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmvi
ngyevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrl
tmlltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk

SCOPe Domain Coordinates for d1il2b3:

Click to download the PDB-style file with coordinates for d1il2b3.
(The format of our PDB-style files is described here.)

Timeline for d1il2b3: