Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species) |
Species Escherichia coli [TaxId:562] [55699] (3 PDB entries) |
Domain d1il2b3: 1il2 B:1107-1287,B:1421-1585 [66198] Other proteins in same PDB: d1il2a1, d1il2a2, d1il2b1, d1il2b2 protein/RNA complex; complexed with amo, so4 |
PDB Entry: 1il2 (more details), 2.6 Å
SCOPe Domain Sequences for d1il2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1il2b3 d.104.1.1 (B:1107-1287,B:1421-1585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} vlpldsnhvnteearlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmlt katpegardylvpsrvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrq peftqidvetsfmtapqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdl rXdeskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmvi ngyevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrl tmlltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk
Timeline for d1il2b3: