SCOP 1.67: Domain d1il2b3: 1il2 B:1107-1287,B:1421-1585

Lineage for d1il2b3 (1il2 B:1107-1287,B:1421-1585)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)

7. Species Escherichia coli [TaxId:562] [55699] (3 PDB entries)

8. Domain d1il2b3: 1il2 B:1107-1287,B:1421-1585 [66198]
   Other proteins in same PDB: d1il2a1, d1il2a2, d1il2b1, d1il2b2
   complexed with 1mg, 5mc, 5mu, amo, h2u, psu, so4

Details for d1il2b3

PDB Entry: 1il2, 2.6 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase:yeast trnaasp:aspartyl-adenylate complex

SCOP Domain Sequences for d1il2b3:

Sequence; same for both SEQRES and ATOM records:

>d1il2b3 d.104.1.1 (B:1107-1287,B:1421-1585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli}
vlpldsnhvnteearlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmlt
katpegardylvpsrvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrq
peftqidvetsfmtapqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdl
rXdeskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmvi
ngyevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrl
tmlltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk

Timeline for d1il2b3:

• d1il2b3 first appeared in SCOP 1.59
  
• d1il2b3 appears in SCOP 1.65
  
• d1il2b3 appears in SCOP 1.69
  
• d1il2b3 appears in the current release, SCOPe 2.08