Lineage for d1il2b3 (1il2 B:1107-1287,B:1421-1585)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136439Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 136440Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 136441Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)
  6. 136448Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species)
  7. 136458Species Escherichia coli [TaxId:562] [55699] (3 PDB entries)
  8. 136461Domain d1il2b3: 1il2 B:1107-1287,B:1421-1585 [66198]
    Other proteins in same PDB: d1il2a1, d1il2a2, d1il2b1, d1il2b2

Details for d1il2b3

PDB Entry: 1il2 (more details), 2.6 Å

PDB Description: Crystal Structure of the E. coli Aspartyl-tRNA Synthetase:Yeast tRNAasp:aspartyl-Adenylate Complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1il2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il2b3 d.104.1.1 (B:1107-1287,B:1421-1585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli}
vlpldsnhvnteearlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmlt
katpegardylvpsrvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrq
peftqidvetsfmtapqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdl
rXdeskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmvi
ngyevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrl
tmlltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk

SCOP Domain Coordinates for d1il2b3:

Click to download the PDB-style file with coordinates for d1il2b3.
(The format of our PDB-style files is described here.)

Timeline for d1il2b3: