Lineage for d1il2b2 (1il2 B:1288-1420)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1657192Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 1657193Family d.74.4.1: GAD domain [55262] (2 proteins)
    has additional structures inserted in the common fold loops
  6. 1657201Protein Prokaryotic AspRS, insert domain [55263] (2 species)
  7. 1657202Species Escherichia coli [TaxId:562] [55264] (3 PDB entries)
  8. 1657205Domain d1il2b2: 1il2 B:1288-1420 [66197]
    Other proteins in same PDB: d1il2a1, d1il2a3, d1il2b1, d1il2b3
    protein/RNA complex; complexed with amo, so4

Details for d1il2b2

PDB Entry: 1il2 (more details), 2.6 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase:yeast trnaasp:aspartyl-adenylate complex
PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1il2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il2b2 d.74.4.1 (B:1288-1420) Prokaryotic AspRS, insert domain {Escherichia coli [TaxId: 562]}
npmeltdvadllksvefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygak
glayikvnerakgleginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamg
alrlkvgkdlglt

SCOPe Domain Coordinates for d1il2b2:

Click to download the PDB-style file with coordinates for d1il2b2.
(The format of our PDB-style files is described here.)

Timeline for d1il2b2: