Lineage for d1il2b2 (1il2 B:1288-1420)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413929Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 414034Superfamily d.74.4: Prokaryotic AspRS, insert domain [55261] (1 family) (S)
  5. 414035Family d.74.4.1: Prokaryotic AspRS, insert domain [55262] (1 protein)
    has additional structures inserted in the common fold loops
  6. 414036Protein Prokaryotic AspRS, insert domain [55263] (2 species)
  7. 414037Species Escherichia coli [TaxId:562] [55264] (3 PDB entries)
  8. 414040Domain d1il2b2: 1il2 B:1288-1420 [66197]
    Other proteins in same PDB: d1il2a1, d1il2a3, d1il2b1, d1il2b3
    complexed with 1mg, 5mc, 5mu, amo, h2u, psu, so4

Details for d1il2b2

PDB Entry: 1il2 (more details), 2.6 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase:yeast trnaasp:aspartyl-adenylate complex

SCOP Domain Sequences for d1il2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il2b2 d.74.4.1 (B:1288-1420) Prokaryotic AspRS, insert domain {Escherichia coli}
npmeltdvadllksvefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygak
glayikvnerakgleginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamg
alrlkvgkdlglt

SCOP Domain Coordinates for d1il2b2:

Click to download the PDB-style file with coordinates for d1il2b2.
(The format of our PDB-style files is described here.)

Timeline for d1il2b2: