Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.74: DCoH-like [55247] (4 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.4: Prokaryotic AspRS, insert domain [55261] (1 family) |
Family d.74.4.1: Prokaryotic AspRS, insert domain [55262] (1 protein) has additional structures inserted in the common fold loops |
Protein Prokaryotic AspRS, insert domain [55263] (2 species) |
Species Escherichia coli [TaxId:562] [55264] (3 PDB entries) |
Domain d1il2b2: 1il2 B:1288-1420 [66197] Other proteins in same PDB: d1il2a1, d1il2a3, d1il2b1, d1il2b3 complexed with 1mg, 5mc, 5mu, amo, h2u, psu, so4 |
PDB Entry: 1il2 (more details), 2.6 Å
SCOP Domain Sequences for d1il2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1il2b2 d.74.4.1 (B:1288-1420) Prokaryotic AspRS, insert domain {Escherichia coli} npmeltdvadllksvefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygak glayikvnerakgleginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamg alrlkvgkdlglt
Timeline for d1il2b2: