Lineage for d1il2b1 (1il2 B:1001-1106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541120Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1541121Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 1541128Species Escherichia coli [TaxId:562] [50254] (3 PDB entries)
  8. 1541131Domain d1il2b1: 1il2 B:1001-1106 [66196]
    Other proteins in same PDB: d1il2a2, d1il2a3, d1il2b2, d1il2b3
    protein/RNA complex; complexed with amo, so4

Details for d1il2b1

PDB Entry: 1il2 (more details), 2.6 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase:yeast trnaasp:aspartyl-adenylate complex
PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1il2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il2b1 b.40.4.1 (B:1001-1106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]}
mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
selrnefciqvtgtvrardekninrdmatgeievlassltiinrad

SCOPe Domain Coordinates for d1il2b1:

Click to download the PDB-style file with coordinates for d1il2b1.
(The format of our PDB-style files is described here.)

Timeline for d1il2b1: