Lineage for d1il2a3 (1il2 A:107-287,A:421-585)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416610Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 416611Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 416612Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)
  6. 416622Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 416632Species Escherichia coli [TaxId:562] [55699] (3 PDB entries)
  8. 416634Domain d1il2a3: 1il2 A:107-287,A:421-585 [66195]
    Other proteins in same PDB: d1il2a1, d1il2a2, d1il2b1, d1il2b2

Details for d1il2a3

PDB Entry: 1il2 (more details), 2.6 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase:yeast trnaasp:aspartyl-adenylate complex

SCOP Domain Sequences for d1il2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il2a3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli}
vlpldsnhvnteearlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmlt
katpegardylvpsrvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrq
peftqidvetsfmtapqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdl
rXdeskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmvi
ngyevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrl
tmlltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk

SCOP Domain Coordinates for d1il2a3:

Click to download the PDB-style file with coordinates for d1il2a3.
(The format of our PDB-style files is described here.)

Timeline for d1il2a3: