![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.4: GAD domain-like [55261] (2 families) ![]() |
![]() | Family d.74.4.1: GAD domain [55262] (2 proteins) has additional structures inserted in the common fold loops |
![]() | Protein Prokaryotic AspRS, insert domain [55263] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55264] (3 PDB entries) |
![]() | Domain d1il2a2: 1il2 A:288-420 [66194] Other proteins in same PDB: d1il2a1, d1il2a3, d1il2b1, d1il2b3 protein/RNA complex; complexed with amo, so4 |
PDB Entry: 1il2 (more details), 2.6 Å
SCOPe Domain Sequences for d1il2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1il2a2 d.74.4.1 (A:288-420) Prokaryotic AspRS, insert domain {Escherichia coli [TaxId: 562]} npmeltdvadllksvefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygak glayikvnerakgleginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamg alrlkvgkdlglt
Timeline for d1il2a2: