SCOPe 2.03: Domain d1il2a1: 1il2 A:1-106

Lineage for d1il2a1 (1il2 A:1-106)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
   this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes

7. Species Escherichia coli [TaxId:562] [50254] (3 PDB entries)

8. Domain d1il2a1: 1il2 A:1-106 [66193]
   Other proteins in same PDB: d1il2a2, d1il2a3, d1il2b2, d1il2b3
   protein/RNA complex; complexed with amo, so4

Details for d1il2a1

PDB Entry: 1il2, 2.6 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase:yeast trnaasp:aspartyl-adenylate complex

PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1il2a1:

Sequence; same for both SEQRES and ATOM records:

>d1il2a1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]}
mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
selrnefciqvtgtvrardekninrdmatgeievlassltiinrad

Timeline for d1il2a1:

• d1il2a1 first appeared in SCOP 1.59
  
• d1il2a1 appears in SCOPe 2.02
  
• d1il2a1 appears in SCOPe 2.04
  
• d1il2a1 appears in the current release, SCOPe 2.08