![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) ![]() |
![]() | Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
![]() | Species Escherichia coli [TaxId:562] [50254] (3 PDB entries) |
![]() | Domain d1il2a1: 1il2 A:1-106 [66193] Other proteins in same PDB: d1il2a2, d1il2a3, d1il2b2, d1il2b3 |
PDB Entry: 1il2 (more details), 2.6 Å
SCOP Domain Sequences for d1il2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1il2a1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli} mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla selrnefciqvtgtvrardekninrdmatgeievlassltiinrad
Timeline for d1il2a1: