Lineage for d1ikpa3 (1ikp A:252-394)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1454901Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1455152Superfamily f.1.5: Exotoxin A, middle domain [56864] (1 family) (S)
    automatically mapped to Pfam PF09102
  5. 1455153Family f.1.5.1: Exotoxin A, middle domain [56865] (1 protein)
  6. 1455154Protein Exotoxin A, middle domain [56866] (1 species)
    six-helical domain
  7. 1455155Species Pseudomonas aeruginosa [TaxId:287] [56867] (2 PDB entries)
  8. 1455156Domain d1ikpa3: 1ikp A:252-394 [66184]
    Other proteins in same PDB: d1ikpa1, d1ikpa2
    complexed with cl, na; mutant

Details for d1ikpa3

PDB Entry: 1ikp (more details), 1.45 Å

PDB Description: pseudomonas aeruginosa exotoxin a, p201q, w281a mutant
PDB Compounds: (A:) exotoxin a

SCOPe Domain Sequences for d1ikpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikpa3 f.1.5.1 (A:252-394) Exotoxin A, middle domain {Pseudomonas aeruginosa [TaxId: 287]}
eggslaaltahqachlpletftrhrqprgaeqleqcgypvqrlvalylaarlswnqvdqv
irnalaspgsggdlgeaireqpeqarlaltlaaaeserfvrqgtgndeagaanadvvslt
cpvaagecagpadsgdallerny

SCOPe Domain Coordinates for d1ikpa3:

Click to download the PDB-style file with coordinates for d1ikpa3.
(The format of our PDB-style files is described here.)

Timeline for d1ikpa3: