Lineage for d1ikpa1 (1ikp A:2-251)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043539Family b.29.1.7: Exotoxin A, N-terminal domain [49962] (1 protein)
    automatically mapped to Pfam PF09101
  6. 2043540Protein Exotoxin A, N-terminal domain [49963] (1 species)
  7. 2043541Species Pseudomonas aeruginosa [TaxId:287] [49964] (2 PDB entries)
  8. 2043542Domain d1ikpa1: 1ikp A:2-251 [66182]
    Other proteins in same PDB: d1ikpa2, d1ikpa3
    complexed with cl, na; mutant

Details for d1ikpa1

PDB Entry: 1ikp (more details), 1.45 Å

PDB Description: Pseudomonas Aeruginosa Exotoxin A, P201Q, W281A mutant
PDB Compounds: (A:) exotoxin a

SCOPe Domain Sequences for d1ikpa1:

Sequence, based on SEQRES records: (download)

>d1ikpa1 b.29.1.7 (A:2-251) Exotoxin A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
eeafdlwnecakacvldlkdgvrssrmsvdpaiadtngqgvlhysmvleggndalklaid
nalsitsdgltirleggvepnkpvrysytrqargswslnwlvpighekpsnikvfiheln
agnqlshmspiytiemgdellaklardatffvrahesnemqptlaishagvsvvmaqaqp
rrekrwsewasgkvlclldqldgvynylaqqrcnlddtwegkiyrvlagnpakhdldikp
tvishrlhfp

Sequence, based on observed residues (ATOM records): (download)

>d1ikpa1 b.29.1.7 (A:2-251) Exotoxin A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
eeafdlwnecakacvldlkdgvrssrmsvdpaiadtngqgvlhysmvleggndalklaid
nalsitsdgltirleggvepnkpvrysytrqargswslnwlvpighekpsnikvfiheln
agnqlshmspiytiemgdellaklardatffvrahesnemqptlaishagvsvvmaqkrw
sewasgkvlclldqldgvynylaqqrcnlddtwegkiyrvlagnpakhdldikptvishr
lhfp

SCOPe Domain Coordinates for d1ikpa1:

Click to download the PDB-style file with coordinates for d1ikpa1.
(The format of our PDB-style files is described here.)

Timeline for d1ikpa1: