Lineage for d1ik6a1 (1ik6 A:1-191)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393047Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 393048Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 393157Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (3 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 393176Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species)
  7. 393177Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [69473] (1 PDB entry)
  8. 393178Domain d1ik6a1: 1ik6 A:1-191 [66174]
    Other proteins in same PDB: d1ik6a2
    structure determined on its own rather in the complex with E1-alpha

Details for d1ik6a1

PDB Entry: 1ik6 (more details), 2 Å

PDB Description: 3D structure of the E1beta subunit of pyruvate dehydrogenase from the archeon Pyrobaculum aerophilum

SCOP Domain Sequences for d1ik6a1:

Sequence, based on SEQRES records: (download)

>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum}
vagvvmmanmakainmalheemerdervvvlgedvgkkggvflvteglyerfgpervidt
plneggilgfamgmamaglkpvaeiqfvdfiwlgadellnhiaklryrsggnykaplvvr
tpvgsgtrgglyhsnspeaifvhtpglvvvmpstpynakgllkaairgddpvvflepkil
yrapreevpeg

Sequence, based on observed residues (ATOM records): (download)

>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum}
vagvvmmanmakainmalheemerdervvvlgelvteglyerfgpervidtplneggilg
famgmamaglkpvaeiqfvlgadellnhiaklrykaplvvrtpvgspeaifvhtpglvvv
mpstpynakgllkaairgddpvvflepkilyrapreevpeg

SCOP Domain Coordinates for d1ik6a1:

Click to download the PDB-style file with coordinates for d1ik6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ik6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ik6a2