SCOP 1.67: Domain d1ik6a1: 1ik6 A:1-191

Lineage for d1ik6a1 (1ik6 A:1-191)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (3 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [69473] (1 PDB entry)

8. Domain d1ik6a1: 1ik6 A:1-191 [66174]
   Other proteins in same PDB: d1ik6a2
   structure determined on its own rather in the complex with E1-alpha

Details for d1ik6a1

PDB Entry: 1ik6, 2 Å

PDB Description: 3D structure of the E1beta subunit of pyruvate dehydrogenase from the archeon Pyrobaculum aerophilum

SCOP Domain Sequences for d1ik6a1:

Sequence, based on SEQRES records:

>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum}
vagvvmmanmakainmalheemerdervvvlgedvgkkggvflvteglyerfgpervidt
plneggilgfamgmamaglkpvaeiqfvdfiwlgadellnhiaklryrsggnykaplvvr
tpvgsgtrgglyhsnspeaifvhtpglvvvmpstpynakgllkaairgddpvvflepkil
yrapreevpeg

Sequence, based on observed residues (ATOM records):

>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum}
vagvvmmanmakainmalheemerdervvvlgelvteglyerfgpervidtplneggilg
famgmamaglkpvaeiqfvlgadellnhiaklrykaplvvrtpvgspeaifvhtpglvvv
mpstpynakgllkaairgddpvvflepkilyrapreevpeg

Timeline for d1ik6a1:

• d1ik6a1 first appeared in SCOP 1.59
  
• d1ik6a1 appears in SCOP 1.65
  
• d1ik6a1 appears in SCOP 1.69
  
• d1ik6a1 appears in the current release, SCOPe 2.08