Lineage for d1ik3a2 (1ik3 A:9-167)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045908Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2045909Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2045910Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 2045914Protein Plant lipoxigenase [49725] (2 species)
  7. 2045944Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (10 PDB entries)
    Uniprot P09186
  8. 2045947Domain d1ik3a2: 1ik3 A:9-167 [66173]
    Other proteins in same PDB: d1ik3a1
    complexed with 11o, 13r, 13s, 9oh, fe

Details for d1ik3a2

PDB Entry: 1ik3 (more details), 2 Å

PDB Description: lipoxygenase-3 (soybean) complex with 13(s)-hydroperoxy-9(z),11(e)- octadecadienoic acid
PDB Compounds: (A:) lipoxygenase-3

SCOPe Domain Sequences for d1ik3a2:

Sequence, based on SEQRES records: (download)

>d1ik3a2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
sltledipnhgsihfvcnswiynaklfksdriffanqty

Sequence, based on observed residues (ATOM records): (download)

>d1ik3a2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
ghkikgtvvlmrknvldvnsvtsvtldtltaflgrsvslqlisatkadangkgklgkatf
legiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflvsltledipnhgsi
hfvcnswiynaklfksdriffanqty

SCOPe Domain Coordinates for d1ik3a2:

Click to download the PDB-style file with coordinates for d1ik3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ik3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ik3a1