Lineage for d1ik3a1 (1ik3 A:168-857)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100855Fold a.119: Lipoxigenase [48483] (1 superfamily)
  4. 100856Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 100857Family a.119.1.1: Plant lipoxigenases [48485] (1 protein)
  6. 100858Protein Lipoxigenase, C-terminal domain [48486] (2 species)
  7. 100868Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [48488] (3 PDB entries)
  8. 100869Domain d1ik3a1: 1ik3 A:168-857 [66172]
    Other proteins in same PDB: d1ik3a2

Details for d1ik3a1

PDB Entry: 1ik3 (more details), 2 Å

PDB Description: lipoxygenase-3 (soybean) complex with 13(s)-hydroperoxy-9(z),11(e)- octadecadienoic acid

SCOP Domain Sequences for d1ik3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ik3a1 a.119.1.1 (A:168-857) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L3}
lpsetpaplvkyreeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggn
dtfpyprrgrtgrkptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpl
lqsafdlnftprefdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpp
pkviqvsksawmtdeefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehle
pnlegltvdeaiqnkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplai
elslphpqgdqsgafsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavve
pfiiatnrhlsvvhpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsa
vvykdwvftdqalpadlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvhey
vflyyksddtlredpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasa
lhaavnfgqypygglilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidl
svieilsrhasdevylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnr
cgpvqmpytlllpsskegltfrgipnsisi

SCOP Domain Coordinates for d1ik3a1:

Click to download the PDB-style file with coordinates for d1ik3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ik3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ik3a2