Lineage for d1ijwc_ (1ijw C:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 94901Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 94999Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 95006Protein HIN recombinase (DNA-binding domain) [46729] (1 species)
  7. 95007Species Synthetic [46730] (8 PDB entries)
  8. 95009Domain d1ijwc_: 1ijw C: [66171]

Details for d1ijwc_

PDB Entry: 1ijw (more details), 2.4 Å

PDB Description: Testing the Water-Mediated Hin Recombinase DNA Recognition by Systematic Mutations.

SCOP Domain Sequences for d1ijwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic}
grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassi

SCOP Domain Coordinates for d1ijwc_:

Click to download the PDB-style file with coordinates for d1ijwc_.
(The format of our PDB-style files is described here.)

Timeline for d1ijwc_: