SCOP 1.73: Domain d1ijlb_: 1ijl B:

Lineage for d1ijlb_ (1ijl B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Viper (Deinagkistrodon acutus) [TaxId:36307] [69122] (1 PDB entry)

8. Domain d1ijlb_: 1ijl B: [66164]
   complexed with ca, zn

Details for d1ijlb_

PDB Entry: 1ijl, 2.6 Å

PDB Description: Crystal structure of acidic phospholipase A2 from deinagkistrodon acutus

PDB Compounds: (B:) phospholipase a2

SCOP Domain Sequences for d1ijlb_:

Sequence; same for both SEQRES and ATOM records:

>d1ijlb_ a.133.1.2 (B:) Snake phospholipase A2 {Viper (Deinagkistrodon acutus) [TaxId: 36307]}
sliqfetlimkvvkksgmfwysaygcycgwgghgrpqdatdrccfvhdccygkvtgcdpk
mdsytyseengdivcggddpckreicecdrvaadcfrdnldtynsdtywryprqdceesp
epc

Timeline for d1ijlb_:

• d1ijlb_ first appeared in SCOP 1.59
  
• d1ijlb_ appears in SCOP 1.71
  
• d1ijlb_ appears in SCOP 1.75
  
• d1ijlb_ appears in the current release, SCOPe 2.08